PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 270aa    MW: 31340.7 Da    PI: 8.5492
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610560.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-182976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v   G g+W+t+a+  g++R++k+c++rw +yl
   XP_013610560.1 29 KGPWTPEEDKLLGEYVSSNGEGRWSTVAKSAGLNRSGKSCRLRWVNYL 76
                     79********************************************97 PP

2Myb_DNA-binding506.8e-1682126147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ ++++++ ++G++ W+tIar+++ gRt++++k++w+++
   XP_013610560.1  82 RGQITPQEEGIILELHSLWGNK-WSTIARYLP-GRTDNEIKNYWRTH 126
                      7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1092480IPR017930Myb domain
SuperFamilySSF466893.67E-3126123IPR009057Homeodomain-like
SMARTSM007172.2E-142878IPR001005SANT/Myb domain
PfamPF002495.1E-172976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-233083IPR009057Homeodomain-like
CDDcd001673.04E-103176No hitNo description
SMARTSM007171.8E-1381129IPR001005SANT/Myb domain
PROSITE profilePS5129419.95281131IPR017930Myb domain
PfamPF002499.8E-1482126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2384130IPR009057Homeodomain-like
CDDcd001672.16E-986126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MLYWGVDQVH HPNHDQDPYK QQQQQGCRKG PWTPEEDKLL GEYVSSNGEG RWSTVAKSAG  60
LNRSGKSCRL RWVNYLRPGL KRGQITPQEE GIILELHSLW GNKWSTIARY LPGRTDNEIK  120
NYWRTHYKKK EKSFSKQEKL RRSRKQLDLK TQPQLQNQQS KLVSEDHINL DNKQNIATYF  180
SYPTSVYNDK FHMPQNVAAT SSDHSMIDEG NFWCSLWSLE DDDPHRFGGG SEQRTATSIA  240
EKFNGGGNEA PFCGSWDYSY NEFYNGGYIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25291307107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610560.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A0D3E0P70.0A0A0D3E0P7_BRAOL; Uncharacterized protein
STRINGBra036202.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-136myb domain protein 121